DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Ctrl

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:242 Identity:82/242 - (33%)
Similarity:127/242 - (52%) Gaps:19/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NGRIVNGYPAYEGKAPYTVGLGFSGNGGW-WCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWR- 96
            |.|||||..|..|..|:.|.|  ..|.|: :||||:||.:||:|||||.....:..:..|...| 
  Rat    31 NQRIVNGENAVPGSWPWQVSL--QDNTGFHFCGGSLIAPNWVVTAAHCKVTPGRHFVILGEYDRS 93

  Fly    97 TNAQFTHTVGSGDFIQNHNW-PNQNGNDIALIR--TPHVDFWHMVNKVELPSFNDRYNMYDNYWA 158
            :||:....:.....|.:.:| ||...||:.|::  :| ..:...|:.|.|.|.|:.  :......
  Rat    94 SNAEPIQVLSISKAITHPSWNPNTMNNDLTLLKLASP-ARYTAQVSPVCLASSNEA--LPAGLTC 155

  Fly   159 VACGWG-LTTAGS-QPDWMECVDLQIISNSECSRTYGTQ-PDGILCVSTSGGKSTCSGDSGGPLV 220
            |..||| ::..|: .|..::.|.|.:::.::|.:.:|:: .|.::|.. ..|.|:|.||||||||
  Rat   156 VTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGSRITDSMICAG-GAGASSCQGDSGGPLV 219

  Fly   221 LHDGGR--LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRDNSGVAY 265
            ...|..  |:|:.||.:.| |....|:.:|||:....||  |..:||
  Rat   220 CQKGNTWVLIGIVSWGTEN-CNVQAPAMYTRVSKFNTWI--NQVIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 76/230 (33%)
Tryp_SPc 37..260 CDD:238113 77/232 (33%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 76/230 (33%)
Tryp_SPc 34..260 CDD:238113 78/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.