DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Ctrl

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:247 Identity:85/247 - (34%)
Similarity:128/247 - (51%) Gaps:29/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NGRIVNGYPAYEGKAPYTVGLGFSGNGGW-WCGGSIIAHDWVLTAAHCTNGASQVT-----IYYG 92
            |.|||||..|..|..|:.|.|  ..|.|: :||||:|:.:||:|||||     |||     :..|
Mouse    31 NQRIVNGENAVPGSWPWQVSL--QDNTGFHFCGGSLISPNWVVTAAHC-----QVTPGRHFVVLG 88

  Fly    93 ATWR-TNAQFTHTVGSGDFIQNHNW-PNQNGNDIALIR--TPHVDFWHMVNKVELPSFNDRYNMY 153
            ...| :||:....:.....|.:.|| .|...||:.|::  :| ..:...|:.|.|.|.|:.  :.
Mouse    89 EYDRSSNAEPVQVLSIARAITHPNWNANTMNNDLTLLKLASP-ARYTAQVSPVCLASTNEA--LP 150

  Fly   154 DNYWAVACGWG-LTTAGS-QPDWMECVDLQIISNSECSRTYGTQ-PDGILCVSTSGGKSTCSGDS 215
            .....|..||| ::..|: .|..::.|.|.:::.::|.:.:|.: .|.::|...||. |:|.|||
Mouse   151 SGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGARITDAMICAGGSGA-SSCQGDS 214

  Fly   216 GGPLVLHDGGR--LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRDNSGVAY 265
            |||||...|..  |:|:.||.:.| |....|:.:|||:....||  |..:||
Mouse   215 GGPLVCQKGNTWVLIGIVSWGTKN-CNIQAPAMYTRVSKFSTWI--NQVMAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 79/235 (34%)
Tryp_SPc 37..260 CDD:238113 80/237 (34%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 79/235 (34%)
Tryp_SPc 34..260 CDD:238113 81/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.