DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and LOC101733231

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_004913565.1 Gene:LOC101733231 / 101733231 -ID:- Length:263 Species:Xenopus tropicalis


Alignment Length:266 Identity:88/266 - (33%)
Similarity:129/266 - (48%) Gaps:24/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGW-WCGG 66
            :::|..||||.......|   |:..|..|.. .|||||..|..|..|:.|.|  ..:..| :|||
 Frog     4 LWLVSCLALATTVYGCGQ---PQIAPVVTGY-ARIVNGEEAVPGSWPWQVSL--QDSTSWHFCGG 62

  Fly    67 SIIAHDWVLTAAHCTNGAS-QVTIYYGATWR-TNAQFTHTVGSGDFIQNHNWPNQN--GNDIALI 127
            |:|.::||:|||||  |.| :..:..|...| :|.:...::.......:..| |.|  .|||:||
 Frog    63 SLINNEWVVTAAHC--GVSTRDKVVLGEHDRGSNVEKIQSLAVAKVFTHPQW-NSNTINNDISLI 124

  Fly   128 R--TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLT--TAGSQPDWMECVDLQIISNSEC 188
            :  ||.| ....|..|.|.:..|.|.  .....|..|||.|  .|.:.|:.::...|.:::|.:|
 Frog   125 KLATPAV-LGATVAPVCLANTGDDYE--GGRICVTSGWGKTRYNAFTTPNQLQQTALPLLTNDQC 186

  Fly   189 SRTYGTQPDGILCVSTSGGKSTCSGDSGGPLV--LHDGGRLVGVTSWVSGNGCTAGLPSGFTRVT 251
            ...:|....|.:..:.:.|.|:|.||||||||  .:|...|||:.||.| :.|:...|:.:.||.
 Frog   187 KSYWGNNITGTMICAGAAGSSSCMGDSGGPLVCQANDAWTLVGIVSWGS-SMCSTSTPAVYARVA 250

  Fly   252 NQLDWI 257
            ....|:
 Frog   251 VLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 78/231 (34%)
Tryp_SPc 37..260 CDD:238113 78/232 (34%)
LOC101733231XP_004913565.1 Tryp_SPc 33..256 CDD:214473 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.