DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Prss8

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:264 Identity:81/264 - (30%)
Similarity:115/264 - (43%) Gaps:31/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHS 93
            |....|....|:.|||.|..|..|:.|:.|.:.:   .|...||||::.:.||::||||....||
Mouse    31 DGTEASCGAVIQPRITGGGSAKPGQWPWQVSITY---DGNHVCGGSLVSNKWVVSAAHCFPREHS 92

  Fly    94 VTIYYGALWRLQAQ------YTHTVGSGHFRQHSDYNTNNLNNDISLI--NTPHVDFWHLINKVE 150
            ...|...|...|..      ..|||  .....||.|.......||:||  ::| |.|...|..:.
Mouse    93 REAYEVKLGAHQLDSYSNDTVVHTV--AQIITHSSYREEGSQGDIALIRLSSP-VTFSRYIRPIC 154

  Fly   151 LPDGNERHDSFA-GWWALASGWGR--PCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITD---- 208
            ||..|.   ||. |.....:|||.  |..|......|..::..:|:|:.||.:|..:.:.:    
Mouse   155 LPAANA---SFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHT 216

  Fly   209 ---NVICTS-TPGGKSTCAGDSGGPL--VLHDRSKLVGVTSFVAASGCTSGLPDGFTRVTSYLDW 267
               :::|.. ..|||..|.|||||||  .:.....|.|:.|:..|.|..: .|..:|..::|..|
Mouse   217 IQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAPN-RPGVYTLTSTYASW 280

  Fly   268 IRDH 271
            |..|
Mouse   281 IHHH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 75/246 (30%)
Tryp_SPc 43..271 CDD:238113 76/248 (31%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.