DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Prss41

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:255 Identity:67/255 - (26%)
Similarity:104/255 - (40%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTH---GAHSVTIYYGALWR 103
            ||..|..:.:|:.|:...|.......   ||||::...||:|||||..   .....|:..|.|..
Mouse    83 RIVGGIESMQGRWPWQASLRLKKSHR---CGGSLLSRRWVLTAAHCFRKYLDPEKWTVQLGQLTS 144

  Fly   104 LQAQYTHTVGSGHFRQHSDYNTNN----LNNDISLIN-TPHVDFWHLINK------VELPDGNER 157
            ..:.:.....||.:|. .|...|:    .::|::|:. ...|.:    ||      |:......:
Mouse   145 KPSYWNRKAYSGRYRV-KDIIVNSEDKLKSHDLALLRLASSVTY----NKDIQPVCVQPSTFTSQ 204

  Fly   158 HDSFAGWWALASGWG------RPCDSCGVSDYLNCVDSQIITRDECSSVYGT----DVITDNVIC 212
            |....  |  .:|||      :|...   ..:|..|...|:....|..::..    .:||.:|.|
Mouse   205 HQPRC--W--VTGWGVLQEDLKPLPP---PYHLREVQVSILNNSRCQELFEIFSLHHLITKDVFC 262

  Fly   213 TSTPGGKS-TCAGDSGGPLV--LHDRSKLVGVTSFVAASGC-TSGLPDGFTRVTSYLDWI 268
            .....|.: ||:||||||||  :......:|:.|:  ..|| ...||..:|.|:.|.:||
Mouse   263 AGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSW--GIGCGRPNLPGIYTNVSHYYNWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 65/253 (26%)
Tryp_SPc 43..271 CDD:238113 66/254 (26%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.