DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Prss32

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:275 Identity:80/275 - (29%)
Similarity:123/275 - (44%) Gaps:55/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHS 93
            |:|.|....|  |||.:|..|..|:.|:.|.:   .::|...||||:|...||:|||||.:...|
Mouse    42 DSVCGRPRTS--GRIVSGQDAQLGRWPWQVSV---RENGAHVCGGSLIAEDWVLTAAHCFNQGQS 101

  Fly    94 VTIYYGALWRLQAQYTHTVGS-------------GHFRQHSDYNTN-NLNNDISLIN--TPHVDF 142
            ::||...|        .|:.|             ..|.:|..|:.: :.:.||:|:.  :| :.|
Mouse   102 LSIYTVLL--------GTISSYPEDNEPKELRAVAQFIKHPSYSADEHSSGDIALVQLASP-ISF 157

  Fly   143 WHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSD------YLNCVDSQIITRDECSSVY 201
            ...:..|.||...:..|.....|  .:|||.    .|.:.      .|..:...:|..:.|::.|
Mouse   158 NDYMLPVCLPKPGDPLDPGTMCW--VTGWGH----IGTNQPLPPPFTLQELQVPLIDAETCNTYY 216

  Fly   202 ------GTD-VITDNVICTS-TPGGKSTCAGDSGGPLV--LHDRSKLVGVTSFVAASGCT-SGLP 255
                  ||: ||.:.::|.. ..|.|..|.||||||||  ::|.....||.|:  .|.|. ...|
Mouse   217 QENSIPGTEPVILEGMLCAGFQEGKKDACNGDSGGPLVCDINDVWIQAGVVSW--GSDCALFKRP 279

  Fly   256 DGFTRVTSYLDWIRD 270
            ..:|.|:.|:.||::
Mouse   280 GVYTNVSVYISWIQN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 73/258 (28%)
Tryp_SPc 43..271 CDD:238113 74/261 (28%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 73/258 (28%)
Tryp_SPc 54..295 CDD:238113 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.