DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and PRSS22

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:285 Identity:73/285 - (25%)
Similarity:118/285 - (41%) Gaps:42/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSGGW 69
            |.:.:.||..||..|  |.|...|...|        .|:..|..:.:.:.|:||.:   ..:|..
Human    22 LLLASTAILNAARIP--VPPACGKPQQL--------NRVVGGEDSTDSEWPWIVSI---QKNGTH 73

  Fly    70 WCGGSIIGHTWVITAAHC----THGAHSVTIYYGALWRL--QAQYTHTVGSGHFRQHSDYN-TNN 127
            .|.||::...||||||||    .:..:..::..|| |:|  ....:..||......|..|: ...
Human    74 HCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGA-WQLGNPGSRSQKVGVAWVEPHPVYSWKEG 137

  Fly   128 LNNDISLINTPH-VDFWHLINKVELPDGN-----ERHDSFAGWWALASGWGRPCDSCGVSDYLNC 186
            ...||:|:.... :.|...:..:.|||.:     ..|...:||.::..|...|....     |..
Human   138 ACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQT-----LQK 197

  Fly   187 VDSQIITRDECSSVY----GTDVITDNVICTS-TPGGKSTCAGDSGGPLV--LHDRSKLVGVTSF 244
            :...||..:.||.:|    |...||::::|.. ..|.:..|.|||||||:  :.....|.|:.|:
Human   198 LKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISW 262

  Fly   245 VAASGCTS-GLPDGFTRVTSYLDWI 268
              ..||.. ..|..:..::::..|:
Human   263 --GEGCAERNRPGVYISLSAHRSWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 62/246 (25%)
Tryp_SPc 43..271 CDD:238113 62/247 (25%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 62/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.