DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and cela1.4

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001020358.1 Gene:cela1.4 / 574008 ZFINID:ZDB-GENE-050626-127 Length:267 Species:Danio rerio


Alignment Length:295 Identity:86/295 - (29%)
Similarity:130/295 - (44%) Gaps:64/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSG 67
            |.:.:|:...|.|.|:|..::.:            :||.|:..|..|.....|:.:.|.|.|...
Zfish     2 LRILLLSTLAALALAEPRYLEDL------------AIEERVVGGEVAKPNSWPWQISLQFLSALD 54

  Fly    68 GW-WCGGSIIGHTWVITAAHCTH---------GAHSVT-------------IYYGALWRLQAQYT 109
            .: .|||::|...||:|||||..         |.|.:|             :|....|.     |
Zfish    55 YFHTCGGTLIRPGWVLTAAHCVDIPRNWRVILGDHDITKHEGHEQSLTVSRVYIHPNWN-----T 114

  Fly   110 HTVGSGHFRQHSDYNTN-NLNNDISLINTPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGR 173
            .:|.||:.......:|: .||:.:.|...|..      .:| ||..||         ...:||||
Zfish   115 DSVSSGYDIALLQLSTDATLNSYVQLATLPPA------GQV-LPHNNE---------CYITGWGR 163

  Fly   174 PCDSCGVSDYLNCVDSQIITRDECS-SVYGTDVITDNVICTSTPGGK-STCAGDSGGPL--VLHD 234
            .......|..|......::..:.|| |.:...::.|.:||:.  ||: |.|.|||||||  :::.
Zfish   164 TQTGGSTSSQLKQALLPVVDHNTCSRSDWWGSIVKDTMICSG--GGEVSGCQGDSGGPLNCLVNG 226

  Fly   235 RSKLVGVTSFVAASGC-TSGLPDGFTRVTSYLDWI 268
            :..:.||||||:|:|| |:..|..||||::|..||
Zfish   227 KYVVHGVTSFVSAAGCNTNKKPTVFTRVSAYNSWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 76/254 (30%)
Tryp_SPc 43..271 CDD:238113 77/255 (30%)
cela1.4NP_001020358.1 Tryp_SPc 29..261 CDD:214473 76/254 (30%)
Tryp_SPc 30..264 CDD:238113 77/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.