DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:276 Identity:86/276 - (31%)
Similarity:122/276 - (44%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHC--THGAHS 93
            |.|..:.::..||..|..|..|..|::|.|   ....|.:||||:|.:.||:|||||  .....|
Zfish    24 VCGRPNPTLNPRIVGGVNATHGAWPWMVSL---QGRYGHFCGGSLINNQWVLTAAHCIVDQTPSS 85

  Fly    94 VTIYYGALWRLQAQYTHTVGS-----GHFRQHSDYNTNNLNNDISLIN-TPHVDFWHLINKVELP 152
            :.:|.|. ||   .|...|.|     .|...|..|:....:|||:|:. |..|.:...|..:.|.
Zfish    86 IIVYLGK-WR---SYVADVNSISRTIRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICLA 146

  Fly   153 DGNERHDSFAGWWALASGWGR-----------------PCDSCGVSDYLNCVDSQIITRDECSSV 200
            |.|.........|  .:|||.                 |....|:   |...:.::.:..:|:::
Zfish   147 DENSNFPRGTNSW--VAGWGDIGVLGTGGIRGRTTVSVPLPHPGI---LQEAELKVYSNADCNNI 206

  Fly   201 -YGTDVITDNVICTST-PGGKSTCAGDSGGPLVLHDRSKL-----VGVTSFVAASGCTS-GLPDG 257
             :|.  ||.|:||..| ||||:|.:|||||||:    :|.     .||.|.  ..||.. .||:.
Zfish   207 CHGR--ITPNMICAGTRPGGKATFSGDSGGPLM----TKCSVWVQAGVLSH--GYGCAQPNLPEV 263

  Fly   258 FTRVTSYLDWIRDHTG 273
            |.||:.|..||..:.|
Zfish   264 FIRVSEYKQWITGNVG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 81/258 (31%)
Tryp_SPc 43..271 CDD:238113 82/260 (32%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 80/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.