DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and zgc:154142

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001092710.1 Gene:zgc:154142 / 555481 ZFINID:ZDB-GENE-070615-2 Length:1090 Species:Danio rerio


Alignment Length:280 Identity:84/280 - (30%)
Similarity:118/280 - (42%) Gaps:72/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SIEGRITNGYPAYEGKVPYIVGLGFSSDSG----GWWCGGSIIGHTWVITAAHC-------TH-- 89
            ::..||.||.||.....|:.|.:....||.    |..|||::|...||:|||||       .|  
Zfish   582 AVNTRIVNGEPANPHSWPWQVSMQVLRDSEPPMLGHTCGGTLIHKNWVLTAAHCFIRYADELHRW 646

  Fly    90 ----GAHSVTIYYGA--LWRLQAQYTH------TVGSGHFRQHSDYNTNNLNNDISLIN------ 136
                |.|::|:....  .:.:...|.|      ||.:..|             ||:|:.      
Zfish   647 KMCLGKHNLTVSESTEQCFNVLGIYRHEGFQYPTVPTVEF-------------DIALVRLDGEVT 698

  Fly   137 -TPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCG------VSDYLNCVDSQIITR 194
             |.|:||..|.:..||..|.::        ..|:|||   |..|      |::.||.|...::..
Zfish   699 ATEHIDFACLPSFEELLPGGKK--------CYATGWG---DETGNSTAPKVAETLNQVALPVVPY 752

  Fly   195 DECSSV-YGTDVITDNVIC---TSTPGGKSTCAGDSGGPLVLHDRS----KLVGVTSFVAASGCT 251
            :.|..: |....:..::||   ||....||.|.||||||||..|..    ::.|:||| ...||.
Zfish   753 ETCKRMDYWWFQVKTSMICCGYTSPDELKSVCQGDSGGPLVCQDSPSAPWEVHGITSF-GPIGCV 816

  Fly   252 -SGLPDGFTRVTSYLDWIRD 270
             ...|..|||.:.||.||.:
Zfish   817 FDKKPSVFTRSSVYLPWIEN 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 82/272 (30%)
Tryp_SPc 43..271 CDD:238113 83/275 (30%)
zgc:154142NP_001092710.1 CUB 57..159 CDD:238001
CUB 172..280 CDD:238001
CUB 310..420 CDD:238001
CUB 432..546 CDD:238001
Tryp_SPc 586..834 CDD:214473 82/272 (30%)
Tryp_SPc 587..837 CDD:238113 83/275 (30%)
CUB 850..959 CDD:238001
CUB 971..1080 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.