DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and ela3l

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_021331840.1 Gene:ela3l / 554107 ZFINID:ZDB-GENE-060710-2 Length:270 Species:Danio rerio


Alignment Length:297 Identity:82/297 - (27%)
Similarity:121/297 - (40%) Gaps:66/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIE---GRITNGYPAYEGKVPYIVGLGFSS 64
            :|..:||..:..:|               .|.|...||   .|:.||..|.....|:.|.|.:.|
Zfish     1 MFALILASVLIASA---------------FGCGKPPIEPLMSRVVNGEEARPHSWPWQVSLQYQS 50

  Fly    65 DSGGW-WCGGSIIGHTWVITAAHCTH---------GAHSVTIYYGALWRLQAQYTHTVGSGHFRQ 119
            .|..: .||||||...||:|||||..         |.|.:::        ..:.:.|:.:.....
Zfish    51 GSSFYHTCGGSIIAENWVMTAAHCISSGRNYRVLVGKHDLSV--------NEEGSQTISAQKIIV 107

  Fly   120 HSDYNTN--NLNNDISLINTPHVDFWHLINKVELPD----------GNERHDSFAGWWALASGWG 172
            |..:|:.  .|.|||:||.        |...|.|.|          |:...:::.   ...||||
Zfish   108 HEKWNSMFVALGNDIALIK--------LAEPVTLSDTIQLGCVPAPGDVLPNNYP---CYISGWG 161

  Fly   173 RPCDSCGVSDYLNCVDSQIITRDECSSV--YGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDR 235
            |......:.|.|.......:....||..  :|:.| .:.::|....|..:.|.|||||||...:.
Zfish   162 RLSTGGALPDRLQQALMPAVDHATCSRFDWWGSSV-KETMVCAGGDGVVAGCNGDSGGPLNCKNS 225

  Fly   236 S---KLVGVTSFVAASGC-TSGLPDGFTRVTSYLDWI 268
            .   ::.|:.|||:..|| |...|..||||:|:.||:
Zfish   226 DGIWEVHGIASFVSGLGCNTIRKPTVFTRVSSFTDWV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 73/253 (29%)
Tryp_SPc 43..271 CDD:238113 73/254 (29%)
ela3lXP_021331840.1 Tryp_SPc 29..265 CDD:238113 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.