DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and ctrb.3

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:292 Identity:85/292 - (29%)
Similarity:127/292 - (43%) Gaps:63/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSGG 68
            ||.:|:.....:||....|..:|  ..|.|      ..||.||..|.....|:.|.|  ...:|.
Zfish     3 FLWLLSCVAFFSAAYGCGVPAIP--PVVSG------YARIVNGEEAVPHSWPWQVSL--QDFTGF 57

  Fly    69 WWCGGSIIGHTWVITAAHCT-HGAHSVTIYYGALWRLQAQYTHTVGSGHFRQ------------H 120
            .:||||:|...||:|||||: ..:|.|.:           ..|..|..:.::            |
Zfish    58 HFCGGSLINEFWVVTAAHCSVRTSHRVIL-----------GEHNKGKSNTQEDIQTMKVSKVFTH 111

  Fly   121 SDYNTNNLNNDISLINTPHVDFWHLINKVELPDGNERH----------DSFA-GWWALASGWG-R 173
            ..||:|.:.|||:|:            |:..|.....|          |:|| |...:.|||| .
Zfish   112 PQYNSNTIENDIALV------------KLTAPASLNAHVSPVCLAEASDNFASGMTCVTSGWGVT 164

  Fly   174 PCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDRS-- 236
            ..::....|.|..|...:::.::|.:.:|:: |.|.:||... .|.|:|.||||||||....:  
Zfish   165 RYNALFTPDELQQVALPLLSNEDCKNHWGSN-IRDTMICAGA-AGASSCMGDSGGPLVCQKDNIW 227

  Fly   237 KLVGVTSFVAASGCTSGLPDGFTRVTSYLDWI 268
            .|||:.|: .:|.|...:|..:.|||...||:
Zfish   228 TLVGIVSW-GSSRCDPTMPGVYGRVTELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 75/252 (30%)
Tryp_SPc 43..271 CDD:238113 75/253 (30%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 75/252 (30%)
Tryp_SPc 34..261 CDD:238113 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.