DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Tpsab1

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:294 Identity:80/294 - (27%)
Similarity:115/294 - (39%) Gaps:56/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSD 65
            :||.|..|.:..:...|.|....|   ::.::|            |..|...|.|:.|.|..:..
  Rat    39 LKLLLLTLPLLSSLVHAAPSLAMP---REGIVG------------GQEASGNKWPWQVSLRVNDT 88

  Fly    66 SGGWWCGGSIIGHTWVITAAHCTHGAHSVT------------IYYGALWRLQAQYTHTVGSGHFR 118
            ....:||||:|...||:|||||. |.:...            :||         :.|.:......
  Rat    89 YWMHFCGGSLIHPQWVLTAAHCV-GPNKADPNKLRVQLRKQYLYY---------HDHLLTVSQII 143

  Fly   119 QHSDYNTNNLNNDISLIN-TPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSD 182
            .|.|:.......||:|:. |..|:....::.|.||..:|...|....|  .:|||...:...:..
  Rat   144 SHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCW--VTGWGNINNDVSLPP 206

  Fly   183 --YLNCVDSQIITRDECSSVY--------GTDVITDNVICTSTPGGKSTCAGDSGGPLV--LHDR 235
              .|..|...|:....|...|        ...::.|:::|....|..| |.||||||||  :.|.
  Rat   207 PFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDS-CQGDSGGPLVCKVEDT 270

  Fly   236 SKLVGVTSFVAASGCTS-GLPDGFTRVTSYLDWI 268
            ....||.|:  ..||.. ..|..:||||.|||||
  Rat   271 WLQAGVVSW--GEGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 70/251 (28%)
Tryp_SPc 43..271 CDD:238113 72/252 (29%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 71/262 (27%)
Tryp_SPc 66..302 CDD:238113 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.