DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CTRB2

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:267 Identity:80/267 - (29%)
Similarity:115/267 - (43%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTH 89
            ||....||...|     ||.||..|..|..|:.|.|  ...:|..:||||:|...||:|||||..
Human    21 VPAIHPVLSGLS-----RIVNGEDAVPGSWPWQVSL--QDKTGFHFCGGSLISEDWVVTAAHCGV 78

  Fly    90 GAHSVTIYYGALWRLQAQYTHTVGSGHFRQHSD-----------------YNTNNLNNDISLIN- 136
            ....|.:                 :|.|.|.||                 ::...:||||:|:. 
Human    79 RTSDVVV-----------------AGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKL 126

  Fly   137 -TPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGR-PCDSCGVSDYLNCVDSQIITRDECSS 199
             || ..|...::.|.||..::  |..||.....:|||: ..::....|.|......:::..||..
Human   127 ATP-ARFSQTVSAVCLPSADD--DFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKK 188

  Fly   200 VYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDRS--KLVGVTSFVAASGCTSGLPDGFTRVT 262
            .:|.. |||.:||... .|.|:|.||||||||.....  .|||:.|: .:..|::..|..:.||.
Human   189 SWGRR-ITDVMICAGA-SGVSSCMGDSGGPLVCQKDGAWTLVGIVSW-GSRTCSTTTPAVYARVA 250

  Fly   263 SYLDWIR 269
            ..:.|::
Human   251 KLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 74/247 (30%)
Tryp_SPc 43..271 CDD:238113 74/249 (30%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 74/247 (30%)
Tryp_SPc 34..259 CDD:238113 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.