DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG11843

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:331 Identity:97/331 - (29%)
Similarity:138/331 - (41%) Gaps:85/331 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLF--LTVLAVAIACAAAQPEKVKPVPLKDAVLGSGS-------------------GSIEGR-- 42
            ||::  .:.|.|::||...|.      |..| |:||.|                   .|||.|  
  Fly     1 MKIWRLFSQLIVSLACVFGQQ------PDMD-VVGSCSRYKKSVFEERIEFGFLLPGASIESRII 58

  Fly    43 ---------ITNGYPAYEGKVPYIVGLGFSSDSGG---WWCGGSIIGHTWVITAAHC---THGAH 92
                     |..|:||...:.|::..||...|...   |:|||.:|...:|:|||||   ..|..
  Fly    59 DNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEV 123

  Fly    93 SVT----IYYGALWRLQAQYTHTVGSGHFRQHSDYNTNNLNNDISLIN-TPHVDFWHLINKVELP 152
            :|.    :.:.:|....|...:.|..  :..|..|......:||.|:. |..|.|....:...||
  Fly   124 NVVRLGELDFDSLDEDAAPRDYMVAG--YIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLP 186

  Fly   153 DGNER-HDSFAGWWALASGWGRPCDSCGVS-------------DYLNCVDSQIITRDECSSVYGT 203
            ..:|| .|||     :|.|||    |.|::             .|.|.|..:::||.......|.
  Fly   187 FQDERSSDSF-----IAVGWG----STGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGF 242

  Fly   204 DVITDNVICTSTPGGKSTCAGDSGGPLVLHDRS-----KLVGVTSFVAASGCTS-GLPDGFTRVT 262
            |  .:|.:|..:...:.||.|||||||:::.|.     .:||:||  |...|.| |:|..:|||.
  Fly   243 D--GNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITS--AGLSCGSPGIPGIYTRVY 303

  Fly   263 SYLDWI 268
            .||.||
  Fly   304 PYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 79/267 (30%)
Tryp_SPc 43..271 CDD:238113 80/257 (31%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 80/257 (31%)
Tryp_SPc 68..309 CDD:214473 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.