DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG11841

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:253 Identity:77/253 - (30%)
Similarity:118/253 - (46%) Gaps:39/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ITNGYPAYEGKVPYIVGLGF--SSDSGGWWCGGSIIGHTWVITAAHC---THGAHSVTIYYGALW 102
            |.:|.||...:.|:...||.  :::...|:|||::|.:..|:|||||   .||..:|.    .|.
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVV----RLG 132

  Fly   103 RLQAQYTHT-------VGSGHFRQHSDYNTNNLNNDISLINTP-HVDFWHLINKVELP-DGNERH 158
            .|:.. |.|       .|....:.|..:....|.|||.::... .|.|....:...|| |..|:|
  Fly   133 ELEFD-TDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQH 196

  Fly   159 DSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDEC-SSVYGTDVITD-----NVICTSTPG 217
            :||     :|.|||:...:...|..|..|..|.. :|.| |||...|.:.:     :.:|..:..
  Fly   197 ESF-----IAIGWGQKKFAQKESKKLLKVQLQGY-KDRCVSSVDANDELPNGYEPKSQLCIGSRD 255

  Fly   218 GKSTCAGDSGGPLVLHDRS-----KLVGVTSFVAASGC-TSGLPDGFTRVTSYLDWIR 269
            .|.||.||||||::.:.:.     .::|:||  |...| |..:|..:|||..:|:||:
  Fly   256 NKDTCNGDSGGPVLAYHKDLACMYHVMGITS--AGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 75/250 (30%)
Tryp_SPc 43..271 CDD:238113 77/253 (30%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 76/251 (30%)
Tryp_SPc 72..310 CDD:214473 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.