DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG31199

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:270 Identity:52/270 - (19%)
Similarity:96/270 - (35%) Gaps:77/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHC------------TH-GAHS 93
            ||..| ..:|||:         .|:|   |.|.::....|:..|||            .| |.|:
  Fly    55 RIVYG-KGFEGKI---------RDNG---CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHN 106

  Fly    94 VTIYYGALWRLQAQY----THTVGSGHFRQHSDYNTNNLNNDISLINTPH-VDFWHLINKVELPD 153
            .:...|........|    :..:.......|.||::..|.|.::::.... ...:..:..:.:|.
  Fly   107 KSAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPP 171

  Fly   154 GNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPGG 218
            .:..:::......:.:|. |..:...:..::|     .::|..|.|...|.|.:.|.:|     |
  Fly   172 PSLLNETLVAQTFVVAGL-RVFEDFRLKTWVN-----TLSRGFCQSKVKTLVTSSNTVC-----G 225

  Fly   219 --KSTCAGDSGGPLV-------LHDRSKLVGV------------TSFVAASGCTSGLPDGFTRVT 262
              |...|...|.|||       :.....|||:            :||:|              :.
  Fly   226 YHKQPVAYYLGAPLVGLQKKGHVTQNYYLVGIMIDWRWENNRIMSSFLA--------------IR 276

  Fly   263 SYLDWIRDHT 272
            :|:|:||.::
  Fly   277 NYMDFIRQNS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 50/264 (19%)
Tryp_SPc 43..271 CDD:238113 51/266 (19%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 44/225 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.