DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG5246

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:298 Identity:83/298 - (27%)
Similarity:124/298 - (41%) Gaps:73/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLTVLAVAIACAAAQPE------------KVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVP 55
            :.::||.:...|:|...:            .|||               |.|:..|..:..|..|
  Fly     5 VLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKP---------------ETRVIGGVDSPTGFAP 54

  Fly    56 YIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQ--------AQYTHTV 112
            |.|.:  .:..|...||||||...|::|||||..            |.:|        ..||.. 
  Fly    55 YQVSI--MNTFGEHVCGGSIIAPQWILTAAHCME------------WPIQYLKIVTGTVDYTRP- 104

  Fly   113 GSGHF----RQHSDYNTNNLNNDISLINTPHVDFW-------HLINKVELPDGNERHDSFAGWWA 166
            |:.:.    :.|..::....:|||:||:|.....:       .|.:|..||...::. :..||.:
  Fly   105 GAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKL-TLTGWGS 168

  Fly   167 LASGWGRPCDSCGVSDYLNCVDSQIITRDECSS-VYGTDVITDNVICTSTPGGKSTCAGDSGGPL 230
            ..: |||      .|..|..:|...|..|.|.| |...:.:::..:||.|..|:.:|.|||||||
  Fly   169 TKT-WGR------YSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPL 226

  Fly   231 VLHDRSKLVGVTSFVAASGCTSGLPDGFTRVTSYLDWI 268
            |..::: ||||.::  ...|..|.||.|..|..|.|||
  Fly   227 VDANQT-LVGVVNW--GEACAIGYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 73/245 (30%)
Tryp_SPc 43..271 CDD:238113 74/246 (30%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 73/245 (30%)
Tryp_SPc 42..263 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436766
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.