DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG17475

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:280 Identity:79/280 - (28%)
Similarity:116/280 - (41%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLAVAIACAAAQP-EKVKPVPLKDAVL---GSGSG-SIEGRITNGYPAYEGKVPYIVGLGFSSDS 66
            :|.:.:||...:| ..|:...|.:..|   ....| :.:.|:.||.....|:..|.:.|  ....
  Fly     9 ILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISL--QGMY 71

  Fly    67 GGWWCGGSIIGHTWVITAAHCTHGAHSV-------TIYY---GALWRLQAQYTHTVGSGHFRQHS 121
            ||..|||.||....|:|||||.:|.:..       |:.|   .|::.::..:.          |.
  Fly    72 GGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWI----------HC 126

  Fly   122 DYNTNNLNNDISLIN-TPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLN 185
            :||:.:.:|||:||. ...:.|.......|||.....:    |...|.:|||.........|.|.
  Fly   127 NYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVAN----GTQLLLTGWGSTELWGDTPDILQ 187

  Fly   186 CVDSQIITRDECSSVYGTDVITDNV-ICTSTPGGKSTCAGDSGGPLVLHDRSKLVGVTSFVAASG 249
            ......:....|..:...|...... |||.|.||:..|.|||||||. |: ..|.|:.::  ...
  Fly   188 KAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLT-HN-GVLYGLVNW--GYP 248

  Fly   250 CTSGLPDGFTRVTSYLDWIR 269
            |..|:||....|..||:|||
  Fly   249 CALGVPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 68/237 (29%)
Tryp_SPc 43..271 CDD:238113 70/239 (29%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 68/237 (29%)
Tryp_SPc 50..269 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.