DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG31265

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:291 Identity:84/291 - (28%)
Similarity:115/291 - (39%) Gaps:58/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSD 65
            |||....|.:.:|.....|.:.|      .::|.......|||..|..|..|..||.|.|  ...
  Fly     1 MKLLRLSLLILLAVKPPNPCESK------RIVGPFPAGQSGRIKGGEEAEIGFAPYQVSL--QPI 57

  Fly    66 SGGWWCGGSIIGHTWVITAAHCTHG---------------AHSVTIYYGALWRLQAQYTHTVGSG 115
            .|...|||:|:...|:|||.||...               |....|||.|               
  Fly    58 VGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTA--------------- 107

  Fly   116 HFRQHSDYNTNNLNNDISLIN-TPHVDFWHLINKVELPD-----GNERHDSFAGWWALASGWGRP 174
            ...:|..|:...::|||:|:. |.::.|..|...:.||.     |.|         .:.:|||..
  Fly   108 EIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEE---------IVLTGWGSD 163

  Fly   175 CDSCGVSDYLNCVDSQIITRDECSSVYG-TDVITDNVICTSTPGGKSTCAGDSGGPLVLHDRSKL 238
            .......:.|:.:...::..|||...:. |..:....|||.:..|:..|.||||||||  ...:|
  Fly   164 VAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLV--SNGQL 226

  Fly   239 VGVTSFVAASGCTSGLPDGFTRVTSYLDWIR 269
            |||.::  ...|..||||....|..||||||
  Fly   227 VGVVNW--GRPCGVGLPDVQANVYYYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 72/247 (29%)
Tryp_SPc 43..271 CDD:238113 74/249 (30%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 72/247 (29%)
Tryp_SPc 39..257 CDD:238113 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.