| Sequence 1: | NP_001285608.1 | Gene: | Jon25Bii / 33707 | FlyBaseID: | FBgn0031654 | Length: | 276 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_536776.2 | Gene: | modSP / 42032 | FlyBaseID: | FBgn0051217 | Length: | 628 | Species: | Drosophila melanogaster |
| Alignment Length: | 251 | Identity: | 54/251 - (21%) |
|---|---|---|---|
| Similarity: | 78/251 - (31%) | Gaps: | 87/251 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 44 TNGYPAYEGKVPYIVGL--GFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQA 106
Fly 107 QYT--HTVGSGHFRQHSDY--------------------NTNNLNNDISLINTPH---------- 139
Fly 140 --VDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITR-DECSSVY 201
Fly 202 GTDV--ITDNVICTSTPGGKSTCAGDSGGPLVLHDRSKLVGVTSFVAASGCTSGLP 255 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Jon25Bii | NP_001285608.1 | Tryp_SPc | 42..268 | CDD:214473 | 54/251 (22%) |
| Tryp_SPc | 43..271 | CDD:238113 | 54/251 (22%) | ||
| modSP | NP_536776.2 | LDLa | 27..58 | CDD:197566 | |
| LDLa | 70..101 | CDD:197566 | |||
| LDLa | 123..157 | CDD:197566 | |||
| LDLa | 167..199 | CDD:238060 | |||
| CCP | <251..284 | CDD:153056 | |||
| Sushi | 309..354 | CDD:278512 | |||
| Tryp_SPc | 371..616 | CDD:214473 | 54/250 (22%) | ||
| Tryp_SPc | 371..591 | CDD:304450 | 54/250 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45436764 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24260 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||