DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG9649

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:304 Identity:83/304 - (27%)
Similarity:123/304 - (40%) Gaps:86/304 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AQPEKVKPVPLKDAVLGSGSGSIEGR--------ITNGYPAYEGKVPYI------VGLGFSSDSG 67
            ||..|..|     ..:|..|| |.||        |.||.....|::|::      ||..::    
  Fly   229 AQASKFYP-----QTIGQLSG-ICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYN---- 283

  Fly    68 GWWCGGSIIGHTWVITAAHC---------------THGAHSVTIY-YGALWRLQAQYTHTVGSGH 116
             :.|||::|....||:||||               :.|.:|:.:: .||          |:|...
  Fly   284 -FLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGA----------TLGVAR 337

  Fly   117 FRQHSDYNTNNLNN-DISLIN-TPHVD---------FWHLINKVELPDGNERHDSFAGWWALASG 170
            ...|..||.|...: |::|:. :.|||         .|:....:|||.|   |.|:      .:|
  Fly   338 LLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSG---HKSY------VAG 393

  Fly   171 WGRPCDSCGVSDYLNCVDSQIITRDECS---SVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVL 232
            ||........:......|:.|||:.||.   |......||.:.||.|.......|:|||||.|:|
  Fly   394 WGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLML 458

  Fly   233 HDRS--KLVGVTSFVAASG------CTSGLPDGFTRVTSYLDWI 268
            .::.  .|.||.|    :|      |...||..:|.|..:::|:
  Fly   459 QEQDIWMLRGVVS----AGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 73/277 (26%)
Tryp_SPc 43..271 CDD:238113 73/270 (27%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 72/268 (27%)
Tryp_SPc 259..497 CDD:214473 71/265 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.