DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG8870

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:250 Identity:56/250 - (22%)
Similarity:92/250 - (36%) Gaps:79/250 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGSIIGHTWVITAAHCTH---------------GAHSVTI-----------YYGALWRLQAQYT 109
            ||||:|.:.:|:|||||..               |.|:.:.           .|..|: ::.:..
  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLY-MEIEVD 180

  Fly   110 HTVGSGHFRQHSDYNT-NNLNNDISLINTPH-VDFWHLINKVELP-----DGNERHDSFAGWWAL 167
            ..:      .|..:|. ..|.|||:|:.... |.:...|..:.||     ..::|....:||..:
  Fly   181 QII------THEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDM 239

  Fly   168 ASGWGRPCDSCGVSDYLNCVDSQIITR--------DECSSVYGTDVITDNVICTSTPGGKSTCAG 224
            ..|                :.|:::.|        |.|.|.|  |....:.||.....|..|..|
  Fly   240 GQG----------------IASEVLLRSFIAERHPDVCKSNY--DFNLGSQICAGGLDGNDTSPG 286

  Fly   225 DSGGPLVLHDRSKLVGVTSFVAASGCTS----------GLPDGFTRVTSYLDWIR 269
            ||||||:   .:.:.|..:...|:|..|          ..|..:|:.:.:.:||:
  Fly   287 DSGGPLM---ETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 54/247 (22%)
Tryp_SPc 43..271 CDD:238113 56/249 (22%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 56/249 (22%)
Tryp_SPc 93..337 CDD:214473 54/247 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435695
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.