DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and snk

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:262 Identity:75/262 - (28%)
Similarity:117/262 - (44%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ITNGYPAYEGKVPYIVGLGFSSDSGG------WWCGGSIIGHTWVITAAHC-THGAHSVTIYYGA 100
            |..|.|...|..|::..||::..||.      |.|||:::...:|:||||| |.|:....:.   
  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMV--- 247

  Fly   101 LWRLQAQYTHTVGSGH-------FRQHSDYNTNNLNNDISLIN-TPHVDF---------WHLINK 148
              ||.|:..:...:..       ...|..|.::...:||:|:. |..|.|         |.| .:
  Fly   248 --RLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQL-PE 309

  Fly   149 VELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTD-----VITD 208
            :::|.            .:|:||||.......|:.|..||..::.:..|..:|..:     .|.:
  Fly   310 LQIPT------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIE 362

  Fly   209 NVICTS-TPGGKSTCAGDSGGPL--VLHDR---SKLVGVTSFVAASGCTS-GLPDGFTRVTSYLD 266
            ...|.. .|||:.||.||||||:  :|.:.   :.:||:|||  ...|.: ..|..:||:.||||
  Fly   363 GQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSF--GKFCAAPNAPGVYTRLYSYLD 425

  Fly   267 WI 268
            ||
  Fly   426 WI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 73/260 (28%)
Tryp_SPc 43..271 CDD:238113 75/262 (29%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 75/262 (29%)
Tryp_SPc 186..427 CDD:214473 73/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.