DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG18223

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:232 Identity:58/232 - (25%)
Similarity:99/232 - (42%) Gaps:62/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 WCGGSIIGHTWVITAAHC-------THGAHSVTIYYGALWRLQAQYTHTVGSGHFR-----QHSD 122
            :|||.||..|:::|:|||       .|.:..:.:..|...||:::...::.....:     :.:.
  Fly    78 FCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFTV 142

  Fly   123 YNTNNL------------NNDISLINTPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGR-- 173
            :||||:            |..:.:||.|..|....:|...|                  ||||  
  Fly   143 FNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYTVL------------------GWGRIF 189

  Fly   174 ---PCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPGG---KSTCAGDSGGPLVL 232
               |.    .||.|: :|.:::.||.|..  ...:..:.::|......   ::.||||:|.||:.
  Fly   190 KGGPL----ASDILH-IDVELLPRDICEK--KVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIF 247

  Fly   233 HDRSKLVGVTSFVAASGCTS-GLPDGFTRVTSYLDWI 268
            ::  .:.||.|:  ..||.| .||..:|.|..::|||
  Fly   248 NE--TVFGVVSY--RVGCGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 56/230 (24%)
Tryp_SPc 43..271 CDD:238113 58/232 (25%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 58/232 (25%)
Tryp_SPc 60..280 CDD:214473 56/230 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436765
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.