DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG18179

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:281 Identity:131/281 - (46%)
Similarity:165/281 - (58%) Gaps:18/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGL----- 60
            |||||..|:||:|..||.|...:...|....:..|:   ||||.|||||.|||.||||||     
  Fly     1 MKLFLLTLSVALAVVAASPGFNRTSLLPQVTISEGA---EGRIVNGYPAPEGKAPYIVGLLIRTD 62

  Fly    61 GFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQAQYTHTVGSGHFRQHSDYNT 125
            |.:|.:.|   .|:||...|::|||||....: |.|:||:.|.....:..:|...:|..|.::..
  Fly    63 GSNSAAVG---AGTIIASDWILTAAHCLTTDY-VEIHYGSNWGWNGAFRQSVRRDNFISHPNWPA 123

  Fly   126 NNLNNDISLINTPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQ 190
            .. ..||.||.||.|.|..|||||.||..:|..|.|...|.:|.||| ..|:..::|:|.|:|.|
  Fly   124 EG-GRDIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWG-GMDNGNLADWLQCMDVQ 186

  Fly   191 IITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDRSKLVGVTSFVAASGCTSGLP 255
            ||:..||...|||...||  :||....|||:|.||||||||.||.::||||.:| .:..|.|| |
  Fly   187 IISNSECEQSYGTVASTD--MCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITF-GSVDCHSG-P 247

  Fly   256 DGFTRVTSYLDWIRDHTGISY 276
            .|:||||.||.||||:|||||
  Fly   248 SGYTRVTDYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 106/230 (46%)
Tryp_SPc 43..271 CDD:238113 108/232 (47%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 106/230 (46%)
Tryp_SPc 40..263 CDD:238113 108/232 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470772
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.