DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG8329

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:275 Identity:126/275 - (45%)
Similarity:165/275 - (60%) Gaps:20/275 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDS 66
            ||.|.:|.||..||.....:.       |..|.|...|   |.|||||||||.||.|||..::.:
  Fly     4 KLVLLLLFVATVCAHRNRNRT-------AHHGGGPKDI---IVNGYPAYEGKAPYAVGLRMNNGA 58

  Fly    67 GGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQAQYTHTVGSGHFRQHSDYNTNNLNND 131
            .|   |||:||:.||:|||||. ...||||:||:......|..|||...:|.:|..| .|:..:|
  Fly    59 VG---GGSVIGNNWVLTAAHCL-TTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGY-PNSAGHD 118

  Fly   132 ISLINTPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDE 196
            |.||.||:|.|.:|||||.||..:::.:.|..||.:|.|||...:. |::|:|.|:|.|:|:..|
  Fly   119 IGLIRTPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANG-GLADWLQCMDVQVISNGE 182

  Fly   197 CSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDRSKLVGVTSFVAASGCTSGLPDGFTRV 261
            |:..||:...||  :||....|||.|.|||||.||.||....|||.:| |:.||.|| |.|:|||
  Fly   183 CARSYGSVASTD--MCTRATDGKSVCGGDSGGALVTHDNPIQVGVITF-ASIGCKSG-PSGYTRV 243

  Fly   262 TSYLDWIRDHTGISY 276
            :.:|||||:.:||:|
  Fly   244 SDHLDWIREKSGIAY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 108/225 (48%)
Tryp_SPc 43..271 CDD:238113 111/227 (49%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 111/227 (49%)
Tryp_SPc 35..250 CDD:214473 108/224 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.