DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG33460

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:236 Identity:49/236 - (20%)
Similarity:89/236 - (37%) Gaps:49/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FSSDSGGW----------WCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQAQYTHTVGSGH 116
            ||:..|.|          :|.|::|...:::|||.|.. .::|.:..|...|    |.:.:...|
  Fly    38 FSTSLGPWTALLHTDGSIFCAGTLITDVFILTAASCIR-PNAVKVRLGEFGR----YPNELPEDH 97

  Fly   117 ----FRQHSDYNTNNLNNDISLINTPHVDFWHLINKVELPDG--------NERHDSFAGWWALAS 169
                |..:..:|..:|.|:|.|:.        |..:|::.|.        |.::...:....:.:
  Fly    98 LVHYFLMYRLFNNESLANNIGLLK--------LTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGN 154

  Fly   170 GWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHD 234
            .|   .:...||  |......|:.:.:.......|:.|.  .|....|...:|.|.:|..|:.:.
  Fly   155 AW---MEDSNVS--LTKELRPIVIQSKPKMCTNLDLYTQ--FCAGHQGNLRSCDGLTGSALIQNS 212

  Fly   235 R--SKLVGVTSFVAA---SGCTSGLPDGFTRVTSYLDWIRD 270
            |  :|...:...:|.   ..|...  .|:|.|..:..||:|
  Fly   213 RYMNKYRHIQFGIATVNDMDCEES--QGYTDVLKFYWWIQD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 46/232 (20%)
Tryp_SPc 43..271 CDD:238113 49/236 (21%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 46/230 (20%)
Tryp_SPc 44..249 CDD:214473 43/226 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.