DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG33465

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:227 Identity:51/227 - (22%)
Similarity:86/227 - (37%) Gaps:53/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGSIIGHTWVITAAHCTHGAHSVTIYYGAL--WRLQAQY--THTVGSGHFRQHSDYNTNNLNND 131
            |.|:::...:|:|||.|......:.:.:|..  :|..:|:  ....|.....|||::..||..||
  Fly    59 CDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVND 123

  Fly   132 ISLI-------NTPHV-------DFWHLINKVELPDGNERHDSFAGW---WALASGWGRPCDSCG 179
            |.|:       :..|:       |  |::.....    ||.:.| ||   ...||...|......
  Fly   124 IGLLRLYGEVTHYAHIRPICIILD--HVVKSAPF----ERFEGF-GWQQQGTEASSQVRQTVYLS 181

  Fly   180 VSDYLNC-VDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLV------LHDRSK 237
            ......| .:.|::.            |.:...|... ..:|.|..:||.||.      :.:.:.
  Fly   182 QKKPFECHRNGQLLP------------INEGQFCAGN-RDRSFCRSNSGSPLTADFTYGVKNITV 233

  Fly   238 LVGVTSFVAASGCTSGLPDG-FTRVTSYLDWI 268
            .||:.|: .:..|:   |.. :|.|.::.|||
  Fly   234 QVGLVSY-GSELCS---PTSVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 49/225 (22%)
Tryp_SPc 43..271 CDD:238113 51/227 (22%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 51/227 (22%)
Tryp_SPc 46..261 CDD:214473 49/225 (22%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.