DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and sphinx2

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:289 Identity:65/289 - (22%)
Similarity:126/289 - (43%) Gaps:49/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSD 65
            |||.:.:|.:::..:..:..|:.|                 |||.||.|....:.|:||:.::..
  Fly     1 MKLVVALLVLSLTFSVCEKNKLSP-----------------RITGGYRAKPYTIIYLVGIVYAKS 48

  Fly    66 --SGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYG---ALW-----RLQAQ--YTHTVGSGHFR 118
              |...:..|:||.:.|::|........: :..::|   |.|     |:..:  |.|        
  Fly    49 PLSSLKFGAGTIISNQWILTVKEVLIFKY-IEAHFGSKRAFWGYDILRIYRENFYFH-------- 104

  Fly   119 QHSDYNTNNLNNDISLINTPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDY 183
                |:...:   |:|:..|:..|...:::|.:|....|.:.:.|...:..|||.......:..:
  Fly   105 ----YDKTRI---IALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTW 162

  Fly   184 LNCVDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLV-LHDRSKLVGVTSFVAA 247
            :.||:.:::...||:. |.|. :....:|||..|.|..|.||.||.:| :......:|:. ::..
  Fly   163 MRCVEVEVMNNTECAK-YHTP-LKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII-WLMP 224

  Fly   248 SGCTSGLPDGFTRVTSYLDWIRDHTGISY 276
            :.|:.|.|....||:.::.||:..:|:.:
  Fly   225 TNCSIGYPSVHIRVSDHIKWIKHVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 56/238 (24%)
Tryp_SPc 43..271 CDD:238113 57/240 (24%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 56/238 (24%)
Tryp_SPc 26..248 CDD:304450 57/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471029
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.