DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG6592

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:269 Identity:102/269 - (37%)
Similarity:142/269 - (52%) Gaps:22/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAH 86
            ::..||.:.:|..|:.::: ||..|........||.||:......|.:|||||:|....||||||
  Fly   103 LETTPLMEKMLPEGAMAMD-RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAH 166

  Fly    87 CTHGAHSVTIYYGA----LWRLQAQYTHTVGSGHFRQHSDYNTNNLNNDISLINTPH-VDFWHLI 146
            |...|....::.||    ..:.:.|....|.|.:|:.:..:|...|.:||:::..|| |.|...|
  Fly   167 CVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERI 231

  Fly   147 NKVELPDGNERHDSFAGWWALASGWGRPCDSC-GVSDYLNCVDSQIITRDECSSVY-----GTDV 205
            :.::||..:..:.||....|:||||||..... .:|:.|..|..|||....|.|.:     ||: 
  Fly   232 HPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTN- 295

  Fly   206 ITDNVICTSTPGGKSTCAGDSGGPLVL---HDRSK-LVGVTSFVAASGCTSGLPDGFTRVTSYLD 266
                 ||||....:|||.|||||||||   |.:.: |||:|||.:..||..|.|..||:|.||||
  Fly   296 -----ICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLD 355

  Fly   267 WIRDHTGIS 275
            ||.|.||:|
  Fly   356 WISDETGVS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 92/240 (38%)
Tryp_SPc 43..271 CDD:238113 93/242 (38%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 92/240 (38%)
Tryp_SPc 123..359 CDD:238113 93/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471028
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.