DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Jon65Aii

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:277 Identity:162/277 - (58%)
Similarity:195/277 - (70%) Gaps:19/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGF-SS 64
            ||:...:|..|.|..||..   :|||:||...|:   .|.||||||||||||||||||.|.| :.
  Fly     1 MKVLGVLLFSAFALVAALE---RPVPVKDMPAGN---KINGRITNGYPAYEGKVPYIVALRFDNG 59

  Fly    65 DSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQAQYTHTVGSGHFRQHSDYNTNNLN 129
            :.|||:||||||||.||:||||||:||..|||.|||:||.|.|:||            |:|.||:
  Fly    60 NGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTH------------YDTGNLH 112

  Fly   130 NDISLINTPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITR 194
            |||:||.|||||||.|:||||||..::|:::|.|||||.||||...||.|::|||||||.||...
  Fly   113 NDIALIRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDN 177

  Fly   195 DECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDRSKLVGVTSFVAASGCTSGLPDGFT 259
            ..|...||:..||.|.:|.:||..|.:|:|||||||||||.::.||:.||.:|:||.|..|.|.|
  Fly   178 SVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLT 242

  Fly   260 RVTSYLDWIRDHTGISY 276
            |||.|||||||||||||
  Fly   243 RVTGYLDWIRDHTGISY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 137/226 (61%)
Tryp_SPc 43..271 CDD:238113 139/228 (61%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 137/226 (61%)
Tryp_SPc 37..254 CDD:238113 139/228 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470692
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.