DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG15873

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:275 Identity:66/275 - (24%)
Similarity:102/275 - (37%) Gaps:56/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LKDAVLG----SGSGSIEGRITNGYPAYEGKVP-YIVGL---GFSSDSG-GWWCGGSIIGHTWVI 82
            |.||.||    ....:.|..|:.||.....::. ::|.:   .:....| ..:|.|.::....|:
  Fly    16 LSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVL 80

  Fly    83 TAAHC-------THGAHSVTIYYGALWRLQAQYTHTVGSGHFRQ------HSDYNTNNLNNDISL 134
            |||||       :.....:.:.:|.:.|| |.|..:    .||.      |.:|.... .||:::
  Fly    81 TAAHCLTDRYKASMNPRGIRVVFGHITRL-AVYDES----DFRSVDRLVVHPEYERYK-KNDLAI 139

  Fly   135 INTPHVDFWHLINKVELPDGNERHDSFA-----------GWWALASGWGRPCDSCGVSDYLNCVD 188
            :        .|..:|:    :..||...           |...:..|||:.......|:.|..:|
  Fly   140 L--------RLSERVQ----SSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNELVYLD 192

  Fly   189 SQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDRSKLVGVTSFVAASGCTSG 253
            ..:.....|...|.| ...|:.:||...|....||||.||||:.  :..|.|:..  ...||..|
  Fly   193 VILRPPSLCQKHYDT-FTADHNVCTEPVGESMNCAGDMGGPLLC--KGALFGLIG--GHMGCAGG 252

  Fly   254 LPDGFTRVTSYLDWI 268
            ....|.....|.|||
  Fly   253 KAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 58/254 (23%)
Tryp_SPc 43..271 CDD:238113 60/255 (24%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 53/236 (22%)
Tryp_SPc 59..250 CDD:238113 49/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471209
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.