DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and try-9

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:93 Identity:31/93 - (33%)
Similarity:40/93 - (43%) Gaps:24/93 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GWGR-PCDSCGVSDYLNCVDSQIITRDECSS--VYGTDVITDNVICTSTPGGKSTCAGDSGGPLV 231
            |:|| |.||...|..|..:.|.:.   |||.  .||      .|.|||......:|.||||..:|
 Worm   161 GYGRDPSDSVLESGKLKSLYSFVA---ECSDDFPYG------GVYCTSAVNRGLSCDGDSGSGVV 216

  Fly   232 LHDRSK----LVGVTSFVAASGCTSGLP 255
            ....::    ||||.|        :|:|
 Worm   217 RTSDTRNVQVLVGVLS--------AGMP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 31/93 (33%)
Tryp_SPc 43..271 CDD:238113 31/93 (33%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 31/93 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.