DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and PRSS48

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:272 Identity:76/272 - (27%)
Similarity:109/272 - (40%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHC-- 87
            :.|....|..|......|:..|..|..|:.|:.|.|.|..:   :.||||::....::|||||  
Human    33 ISLSSLSLVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN---FICGGSLVSERLILTAAHCIQ 94

  Fly    88 -THGAHSVTIYYGALWRLQAQYTHTVGSGHFRQ---------HSDYNTNNLNNDISLIN-TPHVD 141
             |....|.|::.|::         |||....|.         |..|  .:...|::|:. :..|.
Human    95 PTWTTFSYTVWLGSI---------TVGDSRKRVKYYVSKIVIHPKY--QDTTADVALLKLSSQVT 148

  Fly   142 FWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDY---LNCVDSQIITRDECSSVYG- 202
            |...|..:.||...::.......|  .:|||:..:|.. .||   |...:..||.|..|..:|. 
Human   149 FTSAILPICLPSVTKQLAIPPFCW--VTGWGKVKESSD-RDYHSALQEAEVPIIDRQACEQLYNP 210

  Fly   203 --------TDVITDNVICT-STPGGKSTCAGDSGGPLVLHDRSKLV--GVTSFVAASGCTSGLPD 256
                    ..||.::.||. .|...|.:|.|||||||..|.....:  ||.|:  ...|...||.
Human   211 IGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVSW--GLECGKSLPG 273

  Fly   257 GFTRVTSYLDWI 268
            .:|.|..|..||
Human   274 VYTNVIYYQKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 71/253 (28%)
Tryp_SPc 43..271 CDD:238113 72/254 (28%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 71/253 (28%)
Tryp_SPc 51..288 CDD:238113 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.