DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and psh

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:108/268 - (40%) Gaps:69/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQAQ 107
            |..|||...|..|::..:|:.:....:.||||:|...:|:|||||.:...:..    |..||.| 
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTP----AFVRLGA- 203

  Fly   108 YTHTVGSGHFRQ---------HSDYNTNNLNNDISL-------INTPHVDFWHLINKVELPDGNE 156
             .:.....|..|         |..| ..|..|||::       :.|.::....|......|..|.
  Fly   204 -VNIENPDHSYQDIVIRSVKIHPQY-VGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNS 266

  Fly   157 RHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITR--------DECSSVYGTDV-------- 205
            :.        ..:||       ||.:......|:|:.|        |:|:..|....        
  Fly   267 KF--------FVAGW-------GVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQ 316

  Fly   206 -ITDNVICTSTPGGK---STCAGDSGGPLVLHDRS------KLVGVTSFVAASGCTSGLPDGFTR 260
             :.|:::|....  |   ..|.|||||||: |:.:      .::||.|  :..||.:..|..:||
  Fly   317 GVIDSLLCAIDQ--KLIADACKGDSGGPLI-HELNVEDGMYTIMGVIS--SGFGCATVTPGLYTR 376

  Fly   261 VTSYLDWI 268
            |:||||:|
  Fly   377 VSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 69/266 (26%)
Tryp_SPc 43..271 CDD:238113 70/268 (26%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 69/266 (26%)
Tryp_SPc 144..387 CDD:238113 70/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436969
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.