DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Hayan

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:288 Identity:75/288 - (26%)
Similarity:117/288 - (40%) Gaps:59/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSS-DSGGWWCGGSIIGHTWVI 82
            |||.:|.......:.||...:...|.:|.....|..|::..:.::| .|..:.||||:|...:|:
  Fly   361 PEKERPSVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVL 425

  Fly    83 TAAHCTHGAHSVTIYYGALWRLQAQYTHTVGSGH-------FRQHSDYNTNNLNNDISLINTPHV 140
            |||||.:...|...:.    ||.|........|:       .:.|.||:.::...||:::     
  Fly   426 TAAHCVNSDDSTPSFV----RLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAIL----- 481

  Fly   141 DFWHLINKVELPD-------GNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITR---- 194
               .|....:..|       ..:|.|..|.:....:||       ||.:..|...|:|:.|    
  Fly   482 ---QLAEDAKESDVIRPACLYTDRSDPPANYKYFVAGW-------GVMNVTNRAVSKILLRAALD 536

  Fly   195 ----DECSSVYGTD----------VITDNVICTSTPGGKSTCAGDSGGPLVLH-----DRSKLVG 240
                |||::.:...          ||...:........|..|.|||||||:|.     ....:||
  Fly   537 LVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVG 601

  Fly   241 VTSFVAASGCTSGLPDGFTRVTSYLDWI 268
            |.|  :..||.:..|..:|||:|:||:|
  Fly   602 VIS--SGFGCATKTPGLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 68/263 (26%)
Tryp_SPc 43..271 CDD:238113 69/264 (26%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 68/263 (26%)
Tryp_SPc 385..630 CDD:238113 69/264 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436970
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.