DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG31220

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:239 Identity:67/239 - (28%)
Similarity:96/239 - (40%) Gaps:55/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGSIIGHTWVITAAHCTH-----------GAHSVT-----IYYGALWRLQAQYTH-TVGSGHFR 118
            ||||:|...:|:|||||..           |.|:.:     |..||  |:....|| .:......
  Fly   139 CGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGA--RIVCAPTHLDIDVESIT 201

  Fly   119 QHSDYNTNN--LNNDISLIN----TPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDS 177
            .|:||:..|  ..|||:|:.    ..:...::.|..::.|      .|...:....:|||:    
  Fly   202 SHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYP------RSLMKFKMYVAGWGK---- 256

  Fly   178 CGVSDYLNCVDSQIITR--------DECSSVYGTDVITDNV-ICTSTPGGKSTCAGDSGGPLV-L 232
            .|:.|    ..|:::..        :|||..|......... ||......:.||.||||.||: .
  Fly   257 TGMFD----TGSKVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGT 317

  Fly   233 HDRSK-----LVGVTSFVAASGCTSGLPDGFTRVTSYLDWIRDH 271
            ..||.     |.|:||:....| |.|.|..|||...:..|||.|
  Fly   318 SGRSYETITFLAGITSYGGPCG-TIGWPSVFTRTAKFYKWIRAH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 63/234 (27%)
Tryp_SPc 43..271 CDD:238113 66/237 (28%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 63/234 (27%)
Tryp_SPc 104..360 CDD:238113 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435689
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.