DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG31269

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:250 Identity:75/250 - (30%)
Similarity:106/250 - (42%) Gaps:50/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQA 106
            ||..|..|.:|..||.:.|  ...||...|||:||..|:|:|||||...|.       ..|.:..
  Fly    37 RIIGGQAAEDGFAPYQISL--QGISGAHSCGGAIINETFVLTAAHCVENAF-------IPWLVVV 92

  Fly   107 QYTHTV---GSGHFRQ----HSDYNTNNLNNDISLINTPHVDFW-HLINKVELP-----DGNERH 158
            ..|:..   |..:|.:    |.:|:...::|||:|:.......| .....:.||     .|:|  
  Fly    93 TGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDE-- 155

  Fly   159 DSFAGWWALASGWG-------RPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITD-NVICTST 215
                   .:.:|||       .|.|       |..:..|.:...||.::...|...| ..|||.:
  Fly   156 -------VILTGWGSTVLWGTSPID-------LQVLYLQYVPHRECKALLSNDEDCDVGHICTFS 206

  Fly   216 PGGKSTCAGDSGGPLVLHDRSKLVGVTSFVAASGCTSGLPDGFTRVTSYLDWIRD 270
            ..|:..|.||||||||  ....|||:.::  ...|.:|:||....|..|.||||:
  Fly   207 RLGEGACHGDSGGPLV--SNGYLVGLVNW--GWPCATGVPDVHASVYFYRDWIRN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 72/246 (29%)
Tryp_SPc 43..271 CDD:238113 74/248 (30%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/246 (29%)
Tryp_SPc 38..258 CDD:238113 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.