DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG31205

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:239 Identity:61/239 - (25%)
Similarity:91/239 - (38%) Gaps:47/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PYIVGL-GFSSD-SGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQAQYTHTVGSGHF 117
            |::|.: |.:.| |....|.|.:|....|:|||||.....|.:||........:...:.|.:  .
  Fly    50 PWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSA--V 112

  Fly   118 RQHSDYNTNNLNNDISLIN-TPHVDFWHLINKVELPD------GNERHDSFAGWWALASGWGRP- 174
            ..|.||:.....||:::|. |..|.|..|:..:.||.      |:|..:|    ..:.:|...| 
  Fly   113 TVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNS----KLIVAGLEGPS 173

  Fly   175 ----------CDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTST---PGGKSTCAGDS 226
                      .|......|.. :||:     ||......  ..:.:||..|   |...|.....|
  Fly   174 FDRRHSATQRLDKRIKMTYTK-IDSK-----ECHEKQAR--FPEELICGHTERSPLSGSALTEAS 230

  Fly   227 GGPLVLHDRSKLVGVTSFVAASGCTSGLPD--GFTRVTSYLDWI 268
            |.|...|    |:|    :|.:|..|...|  |:..:..:||||
  Fly   231 GTPRQFH----LLG----IAVAGFFSSDLDHQGYLNIRPHLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 59/237 (25%)
Tryp_SPc 43..271 CDD:238113 61/239 (26%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 33/123 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.