DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and spirit

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:248 Identity:69/248 - (27%)
Similarity:107/248 - (43%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ITNGYPAYEGKVPYIVGLGFSSDSGG---WWCGGSIIGHTWVITAAHCTH-----------GAHS 93
            :..|.|....:.|::..||:.|:...   :.|||::|.:.:|:|||||..           |..:
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196

  Fly    94 VTIYYGALWRLQAQYTHTVGSGHFRQHSDYNTNNLNNDISLINTPHVDFWHLINKVEL-PDGNER 157
            :|:..|          ..:.......|.||:.:...|||:|:..      ....|.|| |.....
  Fly   197 LTLTEG----------EDISIRRVIIHPDYSASTAYNDIALLEL------ETAAKPELKPTCIWT 245

  Fly   158 HDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICT-----STPG 217
            ..........|.|:|:...:...|..|..|..:.::.:||...|..|.:...|:.|     ...|
  Fly   246 QKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITG 310

  Fly   218 GKSTCAGDSGGPLVLHD--RSKLVGVTSFVAASGCTSGLPDGFTRVTSYLDWI 268
            .:.||.|||||||::.|  ...:||:||.  ..||.||.|..:|||:|::|||
  Fly   311 ERDTCQGDSGGPLLMQDGLLGYVVGITSL--GQGCASGPPSVYTRVSSFVDWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 67/246 (27%)
Tryp_SPc 43..271 CDD:238113 69/248 (28%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 69/248 (28%)
Tryp_SPc 132..361 CDD:214473 67/246 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.