DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG11664

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:205 Identity:47/205 - (22%)
Similarity:76/205 - (37%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GYPAYE---GKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHC---THGAHSVTIYYGALWRL 104
            |.|..:   |.|..|.|..|.:       .||:....:|:|.|||   ......:::..|..| :
  Fly    26 GIPVQQQNYGYVMQIYGPQFLA-------AGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRW-I 82

  Fly   105 QAQYTHTVGSGHFRQHSDYNTNNLNNDISLINT-PHVDFWHLINKVEL------------PDGNE 156
            ..::.....:|..| |..::...|.|||:::.. ..:...|:||.:.|            |.   
  Fly    83 AWEFRGKQVAGLLR-HPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPP--- 143

  Fly   157 RHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPGGKST 221
              ...|||           :...::..|..:..|:.....|...:  ..|:..|||.|...|:..
  Fly   144 --QELAGW-----------NLMHIAQPLKSMSVQVEPEKNCRQWF--PQISGGVICASATMGEGL 193

  Fly   222 CAGDSGGPLV 231
            |.||||.||:
  Fly   194 CYGDSGDPLI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 47/205 (23%)
Tryp_SPc 43..271 CDD:238113 47/205 (23%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 43/193 (22%)
Tryp_SPc 38..237 CDD:214473 43/193 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.