DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Prss30

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:256 Identity:73/256 - (28%)
Similarity:111/256 - (43%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYY----GAL 101
            |:|..|..|.||:.|:.|.|..:.|  |..||||:|...||:|||||...:.:.:.|:    |..
Mouse    72 GKIVGGQDALEGQWPWQVSLWITED--GHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLT 134

  Fly   102 WRLQAQYTHTVGSGHFRQHSDYN-TNNLNNDISLIN----------TPHVDFWHLINKVELPDGN 155
            ..|...::..|...:...|..|. .:..:.||:|:.          ||          |.||...
Mouse   135 LSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFTP----------VCLPAAQ 189

  Fly   156 ERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVY--------GTDVITDNVIC 212
            .........|  .:|||...:. .::..|..:...::..::|..:|        |..:|..:::|
Mouse   190 TPLTPGTVCW--VTGWGATQER-DMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLC 251

  Fly   213 TS-TPGGKSTCAGDSGGPLVLHDRSK--LVGVTSFVAASGCTSGL-PDGFTRVTSYLDWIR 269
            .. ..|.|.:|.||||||||....|.  .||:||:  ..||.... |..:|||.:|:|||:
Mouse   252 AGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSW--GIGCARPYRPGVYTRVPTYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 70/252 (28%)
Tryp_SPc 43..271 CDD:238113 72/254 (28%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.