DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Cela3b

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:285 Identity:81/285 - (28%)
Similarity:125/285 - (43%) Gaps:37/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSD 65
            ::|..::|.||:|....||                |.:...|:.||..|.....|:.|.|.:..|
  Rat     2 LRLLCSLLLVALASGCGQP----------------SYNPSSRVVNGEDAVPYSWPWQVSLQYEKD 50

  Fly    66 -SGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWR---LQAQYTHTVGSGHFRQHSDYNTN 126
             |....|||::|...||:||.||...:.:..:..|...|   ...:....|.:|....|..:|:|
  Rat    51 GSFHHTCGGTLIAPDWVMTAGHCISTSRTYQVVLGEFERGVEEGPEQVIPVNAGDLFVHPKWNSN 115

  Fly   127 --NLNNDISLIN-TPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVD 188
              :..|||:|:. :........:....||...|...:.|..:  .|||||...:..:.|.|....
  Rat   116 CVSCGNDIALVKLSRSAQLGDTVQLACLPPAGEILPNGAPCY--ISGWGRLSTNGPLPDKLQQAL 178

  Fly   189 SQIITRDECS--SVYGTDVITDNVICTSTPGG--KSTCAGDSGGPL---VLHDRSKLVGVTSFVA 246
            ..::....||  ..:|..| ...::|.   ||  :|.|.|||||||   ..:...::.||||||:
  Rat   179 LPVVDYAHCSKWDWWGFSV-KKTMVCA---GGDIQSGCNGDSGGPLNCPAENGTWQVHGVTSFVS 239

  Fly   247 ASGC-TSGLPDGFTRVTSYLDWIRD 270
            :.|| |...|..||||:::.:||.:
  Rat   240 SLGCNTLKKPTVFTRVSAFNEWIEE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 71/240 (30%)
Tryp_SPc 43..271 CDD:238113 72/243 (30%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 71/240 (30%)
Tryp_SPc 28..265 CDD:238113 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.