DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Mcpt2

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:268 Identity:76/268 - (28%)
Similarity:108/268 - (40%) Gaps:69/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSG-GWWCGGSIIGHTWVITAAHCTHGAHSV 94
            :|.||:|:.|  |..|..:.....||:..|...::.| ...|||.:|...:|:|||||.  ...:
  Rat    11 LLPSGAGAEE--IIGGVESIPHSRPYMAHLDIVTEKGLRVICGGFLISRQFVLTAAHCK--GREI 71

  Fly    95 TIYYGALWRLQAQYTHTVGSGHFRQ----------HSDYNTNNLNNDISLIN-TPHVDFWHLINK 148
            |:..||         |.|......|          |..||:....:||.|:. ...|:....:|.
  Rat    72 TVILGA---------HDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLLKLEKKVELTPAVNV 127

  Fly   149 VELPDGNERHDSFAGWWALASGWGRPCDSCGVSD----YLNCVDSQIITRDECSSV----YGTDV 205
            |.||..::.....|..|  |:|||:    .||.|    .|..|:.:|:....|...    |...|
  Rat   128 VPLPSPSDFIHPGAMCW--AAGWGK----TGVRDPTSYTLREVELRIMDEKACVDYRYYEYKFQV 186

  Fly   206 ITDNVICTSTPGG-KSTCAGDSGGPL----VLHDRSKLVGVTSFVAASGCTSGLPDG-----FTR 260
                  |..:|.. ::...|||||||    |.|      |:.|:        |.||.     |||
  Rat   187 ------CVGSPTTLRAAFMGDSGGPLLCAGVAH------GIVSY--------GHPDAKPPAIFTR 231

  Fly   261 VTSYLDWI 268
            |::|:.||
  Rat   232 VSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 69/255 (27%)
Tryp_SPc 43..271 CDD:238113 71/256 (28%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 70/257 (27%)
Tryp_SPc 21..242 CDD:238113 71/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.