DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Prss34

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:275 Identity:78/275 - (28%)
Similarity:104/275 - (37%) Gaps:75/275 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ITNGYPAYEGKVPYIVGLGFSSDSGGWW---CGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRL 104
            |..|.|....:.|:.|.|.|.:.....|   ||||:|...||:|||||..           |..:
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVE-----------LKEM 86

  Fly   105 QAQYTHTVGSGHFRQHSDYNTNNLNNDISLINTPH---------------------VDFWHLINK 148
            :|. ...|..|..|.   |..:.|.....:|..|.                     |.....::.
  Rat    87 EAS-CFRVQVGQLRL---YENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHP 147

  Fly   149 VELPDGNERHDSFAGWWALASGWG---------RPCDSCGVSDYLNCVDSQIITRDECSSVY--- 201
            |.||..::|..|...||  .:|||         .||       :|..|...|:...:|...|   
  Rat   148 VSLPAASQRISSKKTWW--VAGWGVIEGHRPLPPPC-------HLREVAVPIVGNSDCEQKYRTY 203

  Fly   202 -----GTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDRSK--LVGVTSFVAASGCTSGLPD--- 256
                 .|.:|.|:::|.... |:.:|..|||||||......  .|||.|:  ..||  ||||   
  Rat   204 SSLDRTTKIIKDDMLCAGME-GRDSCQADSGGPLVCRWNCSWVQVGVVSW--GIGC--GLPDFPG 263

  Fly   257 GFTRVTSYLDWIRDH 271
            .:|||.|||.||..:
  Rat   264 VYTRVMSYLSWIHGY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 76/270 (28%)
Tryp_SPc 43..271 CDD:238113 78/273 (29%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 77/271 (28%)
Tryp_SPc 33..275 CDD:214473 76/270 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.