DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Prss30

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:262 Identity:76/262 - (29%)
Similarity:117/262 - (44%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLGSGSGSI----EGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGA 91
            :|..|.|.|    .|:|..|..|.||:.|:.|.|  .::..|..||||:|...||:|||||....
  Rat    15 ILTGGRGDILHSGAGKIVGGQDAPEGRWPWQVSL--RTEKEGHICGGSLIHEVWVLTAAHCFCRP 77

  Fly    92 HSVTIYY----GALWRLQAQYTHTVGSGHFRQHSDYNTNNLNN-DISL--INTPHVDFWHLINKV 149
            .:.:.|:    |....|...::..|...:...:..|...:.:: ||:|  ::||...  ...:.|
  Rat    78 LNSSFYHVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLRLDTPLQP--SQFSPV 140

  Fly   150 ELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVY--------GTDVI 206
            .||............|  .:|||...:. .::..|..:...::..::|..:|        |..||
  Rat   141 CLPQAQAPLTPGTVCW--VTGWGATHER-ELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVI 202

  Fly   207 TDNVICTS-TPGGKSTCAGDSGGPLVLHDRSK--LVGVTSFVAASGCT-SGLPDGFTRVTSYLDW 267
            ..:::|.. ..|.|.:|.||||||||....|.  .||:||:  ..||. ...|..:|||..|:||
  Rat   203 QSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSW--GIGCARPNKPGVYTRVPDYVDW 265

  Fly   268 IR 269
            |:
  Rat   266 IQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 69/244 (28%)
Tryp_SPc 43..271 CDD:238113 71/246 (29%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.