DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG33462

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:230 Identity:57/230 - (24%)
Similarity:93/230 - (40%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQAQYT------------------HTVGS 114
            |:.|.|::|.|.:|:|||||......:|:..|       :|.                  :.|..
  Fly    58 GFHCSGTLINHLFVLTAAHCVPDDLLITVRLG-------EYNTKTKVDCDNHLCQEPFQEYNVDM 115

  Fly   115 GHFRQHSDYNTNNLNNDISLINT-PHVDFWHLINKVELPDGN---ERHDSFAGWWALASGWGRPC 175
            | || |..||.|:..|||.::.. ..|::.:.|..:.:...|   |..|...  |...:.| |..
  Fly   116 G-FR-HRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLT--WFTTTVW-RET 175

  Fly   176 DSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVL------HD 234
            .:...|..|..::.....::.||.:||.::..:.:...:|.  ...|:.|||.|.:.      .|
  Fly   176 AANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTL--SQLCSTDSGAPQIRKMWHNGSD 238

  Fly   235 RSKLVGVTSFVAASGCTSGLPDGFTRVTSYLDWIR 269
            |...:|:.|.|......||:   ...:.||.|||:
  Fly   239 RYVQLGIASRVKGQCQNSGI---LMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 55/227 (24%)
Tryp_SPc 43..271 CDD:238113 57/230 (25%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 57/230 (25%)
Tryp_SPc 48..269 CDD:214473 55/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.