DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Sp212

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:314 Identity:77/314 - (24%)
Similarity:117/314 - (37%) Gaps:95/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPY--------IVGLGFSSDS 66
            |.:..|...|::..|.....:|:....||....|..|.....|:.|:        :..|.|.   
  Fly   244 VTVPPATPPPQRFDPRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFK--- 305

  Fly    67 GGWWCGGSIIGHTWVITAAHCTH-----------GAHSVTIY--YGA--------LWRLQAQYTH 110
                |.||:|..:.||:||||.|           |.:.:..|  .||        ||        
  Fly   306 ----CRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLW-------- 358

  Fly   111 TVGSGHFRQHSDYNTNNLNN-DISLINTPH-VDFWHLINKVELPDGNERHDSFAGWWALAS---- 169
                     |.||||.:.:: ||:||.... |.|..:|..:.:            |...||    
  Fly   359 ---------HPDYNTRSYSDADIALITIERPVTFNDIIAPICM------------WTVEASRTVS 402

  Fly   170 ------GWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGG 228
                  ||||..|| ..:.|...|:::|.:...|:|.:...::|:..:|.....|...|.|||||
  Fly   403 TTGFIAGWGRDEDS-SRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGG 466

  Fly   229 PLVLH--DRSKLVGVTSFVAASGCTSGLPDGFTRVTSY---------LDWIRDH 271
            .|::.  ||..|.|:.| ....|     |.|..::..|         ::||.::
  Fly   467 GLMVKQGDRWLLRGIVS-AGERG-----PAGTCQLNQYVLYCDLSKHINWISEN 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 68/277 (25%)
Tryp_SPc 43..271 CDD:238113 70/279 (25%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 70/279 (25%)
Tryp_SPc 277..511 CDD:214473 68/276 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.