DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG30286

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:249 Identity:71/249 - (28%)
Similarity:108/249 - (43%) Gaps:46/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYG---ALWRLQAQY 108
            :.|:..:.|:   :.:...||...|||:::.|.:::|||||.....::|:..|   :|..:....
  Fly    39 HQAHISESPW---MAYLHKSGELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNG 100

  Fly   109 THTVGSGH-------FRQHSDYNTNNLNNDISLINTP-------HVDFWHLINKVELPDGNERHD 159
            :..:....       || |..|:..|..:||.|:...       |:....||....|....||..
  Fly   101 SDCLPPSEDFEIDVAFR-HGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLH 164

  Fly   160 SFAGWWALASGWGR-PCDSCGVSDYLNCVDSQIITR---DECSSVYGTDVITDNVICTSTPGGKS 220
            ..     :|:|||| |.::..     :.:.|..:||   ..||..|..|...|. ||.|...|.|
  Fly   165 RL-----VATGWGRSPSEAAN-----HILKSIRVTRVNWGVCSKTYWVDRRRDQ-ICVSHESGVS 218

  Fly   221 TCAGDSGGPL---VLHDRSKL---VGVTSFVAASGCTSGLPDGFTRVTSYLDWI 268
             |:||||||:   :..|...|   ||:.|:..|. |.|  |..||.|..::|||
  Fly   219 -CSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAE-CLS--PSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 69/247 (28%)
Tryp_SPc 43..271 CDD:238113 71/249 (29%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 71/249 (29%)
Tryp_SPc 39..268 CDD:214473 69/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.